PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof002497
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 294aa    MW: 30697.4 Da    PI: 7.6118
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-12260PU_refplantGDBView CDS
gnl|UG|Sof#S17340739PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.5e-14114158347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W++eE+ +++ + ++lG+g+W+ I+r   ++Rt+ q+ s+ qk+
        Sof002497 114 PWSEEEHRQFLAGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKF 158
                      8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.682107163IPR017930Myb domain
SuperFamilySSF466893.81E-17108164IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-17110162IPR006447Myb domain, plants
SMARTSM007177.9E-11111161IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-11111154IPR009057Homeodomain-like
CDDcd001678.30E-10114159No hitNo description
PfamPF002498.2E-11114157IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
XGHNSRTCGF GHREIMLCEA GDNGGGSGLR LFGVQVRIGG GGGAGSSASM KKSYSMDCLQ  60
LAAPAGCSLV SPSSSSSSSL LLSIEEGLER GTANGYLSDG PHGRVVQERK KGVPWSEEEH  120
RQFLAGLEKL GKGDWRGISR NYVTTRTPTQ VASHAQKFFL RQSSMGKKKR RSTLFDMVPI  180
CENSASISDP LNSEGASTSL SLNVARHGAA SDSERAALXL NSTEQDDSSR ADASSASGAG  240
SRQFPAAAAQ TELLQPSSHG HGRGHHCSPG ELELGMSLPT PPSEHDAPPL PSSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1166170KKKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.162450.0root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001168009.21e-131uncharacterized protein LOC100381732
TrEMBLA0A0C6WCT70.0A0A0C6WCT7_9POAL; ScMYB42 protein
STRINGGRMZM2G071977_P011e-131(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.15e-39MYB_related family protein